>2qdc_A mol:protein length:309  Tyrosine-protein phosphatase non-receptor type 7
MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVS
PEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQ
GPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKEC
PEYTVRQLTIQYQEERRSVKHILFSAWPAHQTPESAGPLLRLVAEVEESPETAAHPGPI
VVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHT
LALYAGQLPEEPSP
>2qdc_A mol:protein length:309  Tyrosine-protein phosphatase non-receptor type 7
MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVS
PEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQ
GPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKEC
PEYTVRQLTIQYQEERRSVKHILFSAWPAHQTPESAGPLLRLVAEVEESPETAAHPGPI
VVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHT
LALYAGQLPEEPSP