>2qkk_R mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_Z mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_A mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_U mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_K mol:na length:14  5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
CGACACCUGAUUCC
>2qkk_F mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_S mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_H mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_O mol:na length:14  5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
CGACACCUGAUUCC
>2qkk_C mol:na length:14  5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
CGACACCUGAUUCC
>2qkk_G mol:na length:14  5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
CGACACCUGAUUCC
>2qkk_M mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_I mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_Z mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_W mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_B mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_P mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_E mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_N mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_J mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
>2qkk_D mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_T mol:na length:14  5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
CGACACCUGAUUCC
>2qkk_L mol:na length:14  5'-D(*GP*GP*AP*AP*TP*CP*AP*GP*GP*TP*GP*TP*CP*G)-3'
GGAATCAGGTGTCG
>2qkk_X mol:na length:14  5'-R(*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*CP*C)-3'
CGACACCUGAUUCC