>2qkk_B mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED