>2qkk_F mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED