>2qkk_R mol:protein length:154  Ribonuclease H1
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAAC
KAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL
TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED