>2qv8_B mol:protein length:159  General secretion pathway protein H
DEAKISAQSFYQRLLLLNEEAILSGQDFGVRIDVDTRRLTFLQLTADKGWQKWQNDKMT
NQTTLKEGLQLDFELGGGAWQKDDRLFNPGSLFDEEMFADEKKEQKQEPAPQLFVLSSG
EVTPFTLSIFPKGQEPDEQWRVTAQENGTLRLLAPGESDEE