>2qw4_D mol:protein length:273  Orphan nuclear receptor NR4A1
MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDY
SKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAF
LELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPA
FACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPE
LRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
>2qw4_D mol:protein length:273  Orphan nuclear receptor NR4A1
MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDY
SKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAF
LELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPA
FACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPE
LRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
>2qw4_C mol:protein length:273  Orphan nuclear receptor NR4A1
MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDY
SKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAF
LELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPA
FACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPE
LRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
>2qw4_B mol:protein length:273  Orphan nuclear receptor NR4A1
MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDY
SKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAF
LELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPA
FACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPE
LRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
>2qw4_A mol:protein length:273  Orphan nuclear receptor NR4A1
MGSSHHHHHHSSGLVPRGSHMGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDY
SKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAF
LELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPA
FACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPE
LRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF