>2r4s_L mol:protein length:214  antibody for beta2 adrenoceptor, light chain
DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVP
SRFIGTGSGQDYSLTISSLDYADMGIYYCLQYDEFPYTFGGGTKLEIKRADAAPTVSIF
PPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC