>2rve_A mol:protein length:244  PROTEIN (ECO RV (E.C.3.1.21.4))
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHG
YIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTK
NIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPKPYKGVKVFLQDKWVIAG
DLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYR
NWIYRGRK
>2rve_B mol:protein length:244  PROTEIN (ECO RV (E.C.3.1.21.4))
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHG
YIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTK
NIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPKPYKGVKVFLQDKWVIAG
DLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYR
NWIYRGRK
>2rve_F mol:na length:8  DNA (5'-D(*CP*GP*AP*GP*CP*TP*CP*G)-3')
CGAGCTCG
>2rve_D mol:na length:8  DNA (5'-D(*CP*GP*AP*GP*CP*TP*CP*G)-3')
CGAGCTCG
>2rve_F mol:na length:8  DNA (5'-D(*CP*GP*AP*GP*CP*TP*CP*G)-3')
CGAGCTCG
>2rve_C mol:na length:8  DNA (5'-D(*CP*GP*AP*GP*CP*TP*CP*G)-3')
CGAGCTCG
>2rve_E mol:na length:8  DNA (5'-D(*CP*GP*AP*GP*CP*TP*CP*G)-3')
CGAGCTCG