>2stt_B mol:na length:17  DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A)-3')
TCGAGCCGGAAGTTCGA
>2stt_A mol:protein length:96  ETS1
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKR
KNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
>2stt_C mol:na length:17  DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3')
TCGAACTTCCGGCTCGA
>2stt_C mol:na length:17  DNA (5'-D(*TP*CP*GP*AP*AP*CP*TP*TP*CP*CP*GP*GP*CP*TP*CP*GP*A)-3')
TCGAACTTCCGGCTCGA