>2stt_A mol:protein length:96  ETS1
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKR
KNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV