>2tmp_A mol:protein length:127  TISSUE INHIBITOR OF METALLOPROTEINASES-2
CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKD
IEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSL
NHRYQMGCE