>2vbj_B mol:protein length:152  DNA ENDONUCLEASE I-CREI
NTKYNKEFLLYLAGFVDADGSIIAQIEPNQSSKFKHRLKLTFQVTQKTQRRWFLDKLVD
EIGVGYVRDSGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQANLVLKIIEQLPSAKESP
DKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
>2vbj_A mol:protein length:152  DNA ENDONUCLEASE I-CREI
NTKYNKEFLLYLAGFVDGDGSIIAQIEPNQSYKFKHRLKLTFKVTQKTQRRWFLDKLVD
EIGVGYVRDEGSVSNYILSEIKPLRNFLTQLQPFLKLKQKQANLVLKITEQLPSAKESP
DKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
>2vbj_E mol:na length:24  5'-D(*TP*TP*AP*GP*GP*AP*TP*CP*CP*TP *TP*CP*AP*AP*AP*AP*AP*AP*GP*GP*CP*AP*GP*A)-3'
TTAGGATCCTTCAAAAAAGGCAGA
>2vbj_C mol:na length:24  5'-D(*TP*CP*TP*GP*CP*CP*TP*TP*TP*TP *TP*TP*GP*AP*AP*GP*GP*AP*TP*CP*CP*TP*AP*A)-3'
TCTGCCTTTTTTGAAGGATCCTAA
>2vbj_E mol:na length:24  5'-D(*TP*TP*AP*GP*GP*AP*TP*CP*CP*TP *TP*CP*AP*AP*AP*AP*AP*AP*GP*GP*CP*AP*GP*A)-3'
TTAGGATCCTTCAAAAAAGGCAGA