>2vbj_B mol:protein length:152  DNA ENDONUCLEASE I-CREI
NTKYNKEFLLYLAGFVDADGSIIAQIEPNQSSKFKHRLKLTFQVTQKTQRRWFLDKLVD
EIGVGYVRDSGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQANLVLKIIEQLPSAKESP
DKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD