>2vkx_B mol:protein length:209  NEURAL CELL ADHESION MOLECULE
APLAQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWY
DAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQ
RGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAE
YEVYVVAENQQGKSKAAHFVFRTAAAHHHHHH