>2vkx_D mol:protein length:209  NEURAL CELL ADHESION MOLECULE
APLAQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWY
DAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQ
RGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAE
YEVYVVAENQQGKSKAAHFVFRTAAAHHHHHH