>2vm6_A mol:protein length:150  BCL-2-RELATED PROTEIN A1
SMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDN
VNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKE
ISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
>2vm6_B mol:protein length:25  BCL-2-LIKE PROTEIN 11
DMRPEIWIAQELRRIGDEFNAYYAR
>2vm6_B mol:protein length:25  BCL-2-LIKE PROTEIN 11
DMRPEIWIAQELRRIGDEFNAYYAR