>2vm6_A mol:protein length:150  BCL-2-RELATED PROTEIN A1
SMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDN
VNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKE
ISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE