>2vrz_B mol:protein length:99  VIRULENCE FACTOR ESXA
AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQ
LSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
>2vrz_A mol:protein length:99  VIRULENCE FACTOR ESXA
AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQ
LSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
>2vrz_B mol:protein length:99  VIRULENCE FACTOR ESXA
AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQ
LSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ