>2vrz_B mol:protein length:99  VIRULENCE FACTOR ESXA
AHMAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQ
LSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ