>2vsc_B mol:protein length:127  LEUKOCYTE SURFACE ANTIGEN CD47
QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTV
PTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSW
STRHHHHHH
>2vsc_D mol:protein length:127  LEUKOCYTE SURFACE ANTIGEN CD47
QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTV
PTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSW
STRHHHHHH
>2vsc_D mol:protein length:127  LEUKOCYTE SURFACE ANTIGEN CD47
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTV
PTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSW
STRHHHHHH
>2vsc_C mol:protein length:127  LEUKOCYTE SURFACE ANTIGEN CD47
QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTV
PTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSW
STRHHHHHH
>2vsc_A mol:protein length:127  LEUKOCYTE SURFACE ANTIGEN CD47
QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTV
PTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSW
STRHHHHHH