>2vsc_D mol:protein length:127  LEUKOCYTE SURFACE ANTIGEN CD47
QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTV
PTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSW
STRHHHHHH