>2w2q_A mol:protein length:312  PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEE
DGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEF
IRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPAS
APEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSHCSTCFVSQSGTSQA
AAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPS
THGAAGTAAASHHHHHH