>2w2q_P mol:protein length:114  PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARR
LQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ