>2w4g_M mol:protein length:840  MYOSIN HEAVY CHAIN, SKELETAL MUSCLE, ADULT
DAEMAAFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVHPKESFVKGTIQSKEGGKVTV
KTEGGETLTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNPKVVLAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAASGEKKKEEQSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLPAERSYHIFYQIMSNKKPE
LIDMLLITTNPYDYHYVSQGEITVPSIDDQEELMATDSAIDILGFSADEKTAIYKLTGA
VMHYGNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSAELLKALCYPRVKVGNEFVTKG
QTVSQVHNSVGALAKAVYEKMFLWMVIRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSF
EQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFS
ILEEECMFPKATDTSFKNKLYDQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIS
GWLEKNKDPLNETVIGLYQKSSVKTLALLFATYGGEAEGGGGKKGGKKKGSSFQTVSAL
FRENLNKLMANLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGF
PSRVLYADFKQRYRVLNASAIPEGQFMDSKKASEKLLGSIDVDHTQYRFGHTKVFFKAG
LLGLLEEMRDDKLAEIITRTQARCRGFLMRVEYRRMVERRESIFCIQYNVRSFMNVKHW
PWMKLFFKIKPLLK
>2w4g_C mol:protein length:145  MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM
DEINDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKI
TFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEE
VEELMKGQEDSNGCINYEAFVKHIMSV
>2w4g_C mol:protein length:145  MYOSIN LIGHT CHAIN 3, SKELETAL MUSCLE ISOFORM
DEINDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKI
TFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEE
VEELMKGQEDSNGCINYEAFVKHIMSV
>2w4g_B mol:protein length:150  MYOSIN REGULATORY LIGHT CHAIN 2, SKELETAL MUSCLE ISOFORM
NVFSMFDQTQIQDFKEAFTVIDQNRDGIIDKDDLRETFAAMGRLNVKNEELDAMIKEAS
GPINFTVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTQCDRFTPE
EIKNMWAAFPPDVAGNVDYKNICYVITHGEDK