>2w7n_A mol:protein length:101  TRFB TRANSCRIPTIONAL REPRESSOR PROTEIN
MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVW
AAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQETKR