>2w7w_A mol:protein length:194  SUPEROXIDE DISMUTASE [FE]
MSFELPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKT
STGGVFNNAAQIWNHTFYWNCLAPNAGGQPTGAVAAAIDAAFGSFEEFKAKFTDSAINN
FGSSWTWLVKNADGSLAIVNTSNAATPLTDEGVTPLLTVDLWEHAYYIDFRNVRPDYMG
AFWSLVNWSFVEENLAK