>2wh6_A mol:protein length:173  EARLY ANTIGEN PROTEIN R
MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTV
VLRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWM
AWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
>2wh6_B mol:protein length:26  BCL-2-LIKE PROTEIN 11
DMRPEIWIAQELRRIGDEFNAYYARR
>2wh6_B mol:protein length:26  BCL-2-LIKE PROTEIN 11
DMRPEIWIAQELRRIGDEFNAYYARR