>2wh6_A mol:protein length:173  EARLY ANTIGEN PROTEIN R
MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTV
VLRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWM
AWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG