>2wj7_A mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER
>2wj7_C mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER
>2wj7_B mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER
>2wj7_D mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER
>2wj7_E mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER
>2wj7_E mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER