>2wj7_A mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER