>2wj7_C mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPER