>2wy2_B mol:protein length:103  N,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLI
EGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA