>2x36_F mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER
>2x36_A mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER
>2x36_F mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER
>2x36_B mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER
>2x36_C mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER
>2x36_D mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER
>2x36_E mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER