>2x36_B mol:protein length:207  LON PROTEASE HOMOLOG, MITOCHONDRIAL
VERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMK
ESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLAMG
RPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITE
GLEVHFVEHYREIFDIAFPDEQAEALAVER