>2x5q_B mol:protein length:198  SSO1986
GMTSGAGWEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVL
TGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNI
TFSLPIKNFNTGTYQVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDK
LYRDVEEIFNYYSIKSLKSNP