>2x6l_D mol:protein length:69  C-C MOTIF CHEMOKINE 4
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWV
QEYVYDLELN