>2xjf_A mol:protein length:555  CYTOSOLIC PURINE 5'-NUCLEOTIDASE
MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRS
LAMEKIKCFGFNMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRG
LVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFN
LPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEK
TVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSH
RPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTI
CDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQS
LDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQ
VMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSV
DFKDTDYKRHQLTRSISEIKPPNL
>2xjf_A mol:protein length:555  CYTOSOLIC PURINE 5'-NUCLEOTIDASE
MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRS
LAMEKIKCFGFNMDYTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRG
LVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFN
LPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEK
TVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSH
RPWQSYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTI
CDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQS
LDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQ
VMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSV
DFKDTDYKRHQLTRSISEIKPPNL