>2xzf_A mol:protein length:271  FORMAMIDOPYRIMIDINE-DNA GLYCOSYLASE
PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYL
IFEIGDDFRLISHLRMEGKYRLATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELIS
TDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEV
LWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQ
VYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK