>2y1z_B mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHGKY
RIPADVDPLTITSSMSSDGVLTVNGPRKQVSGPER
>2y1z_B mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHGKY
RIPADVDPLTITSSMSSDGVLTVNGPRKQVSGPER
>2y1z_A mol:protein length:94  ALPHA-CRYSTALLIN B CHAIN
GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHGKY
RIPADVDPLTITSSMSSDGVLTVNGPRKQVSGPER