>2y96_B mol:protein length:219  DUAL SPECIFICITY PHOSPHATASE DUPD1
TSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTF
DLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVA
KNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
>2y96_A mol:protein length:219  DUAL SPECIFICITY PHOSPHATASE DUPD1
TSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTF
DLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVA
KNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
>2y96_B mol:protein length:219  DUAL SPECIFICITY PHOSPHATASE DUPD1
TSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTF
DLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVA
KNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL