>2zha_A mol:protein length:437  CCA-adding enzyme
MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLE
IDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLK
EPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCEL
LIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLA
RFVHLCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYP
QLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERN
VKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFE
IISGEKLFKEPVTAELCEMMGVKD
>2zha_B mol:na length:33  tRNA (33-MER)
GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAU
>2zha_B mol:na length:33  tRNA (33-MER)
GGCCCGGGGCGGUUCGAUUCCGCCCUGGGCCAU