>2zjq_2 mol:protein length:47  50S ribosomal protein L34
MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTVSDE