>2zjq_3 mol:protein length:66  50S ribosomal protein L35
MPKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMK
LMLPRGK