>2zjq_J mol:protein length:142  50S ribosomal protein L16
MMLLPKRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHF
RRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEA
FRLAGHKLPIQTKMVKREVYDEAQ