>2zuq_F mol:protein length:221  Fab fragment heavy chain
EVQLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISSGGGSTY
YPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARPDYRSYAMDYWGQGTSVTVS
SAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP