>3a1b_A mol:protein length:159  DNA (cytosine-5)-methyltransferase 3A, Histone H3.1
ARTKQTARKSTGGKAPRKQLRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMC
QNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ
AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHD