>3a9l_B mol:protein length:216  Poly-gamma-glutamate hydrolase
MAQTDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELT
GGSLYLFQGLLPSGNSRLHVTSTHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGL
NTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGKGVQLEISSAQRRAFFQN
NDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLEHHHHHH