>3ag4_G mol:protein length:85  Cytochrome c oxidase subunit 6A2
ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKP
FSWGDGNHTFFHNPRVNPLPTGYEKP