>3ag4_I mol:protein length:73  Cytochrome c oxidase subunit 6C
STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKD
FEEMRKAGIFQSAK